Loading...
Statistics
Advertisement

HIVTravel - Home
www.hivtravel.org/

Hivtravel.org

Advertisement
Hivtravel.org is hosted in France / Paris . Hivtravel.org uses HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Javascript, Number of used javascripts: 1. First javascripts: Libjs.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: Microsoft-IIS/7.5. Its CMS is: DotNetNuke.

Technologies in use by Hivtravel.org

Technology

Number of occurences: 3
  • CSS
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 1
  • Libjs.js

Content Management System

Number of occurences: 1
  • DotNetNuke

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Hivtravel.org

SSL certificate

    • name: /OU=Domain Control Validated/CN=*.iasociety.org
    • subject:
      • OU: Domain Control Validated
      • CN: *.iasociety.org
    • hash: 119e99ff
    • issuer:
      • C: BE
      • O: GlobalSign nv-sa
      • CN: AlphaSSL CA - SHA256 - G2
    • version: 2
    • serialNumber: 1492426292889712674386676710930210253742567
    • validFrom: 150529131739Z
    • validTo: 180529131739Z
    • validFrom_time_t: 1432905459
    • validTo_time_t: 1527599859
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.globalsign.com/repository/
      • subjectAltName: DNS:*.iasociety.org, DNS:iasociety.org
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl2.alphassl.com/gs/gsalphasha2g2.crl
      • authorityInfoAccess: CA Issuers - URI:http://secure2.alphassl.com/cacert/gsalphasha2g2r1.crt OCSP - URI:http://ocsp2.globalsign.com/gsalphasha2g2
      • subjectKeyIdentifier: FC:40:9E:B9:5F:CD:10:E9:10:EE:29:D1:66:C8:65:03:F7:5A:69:54
      • authorityKeyIdentifier: keyid:F5:CD:D5:3C:08:50:F9:6A:4F:3A:B7:97:DA:56:83:E6:69:D2:68:F7

Meta - Hivtravel.org

Number of occurences: 2
  • Name:
    Content: IE=7
  • Name: Keywords
    Content: HIV-specific restrictions on travel and migration, people living with HIV

Server / Hosting

  • IP: 92.222.142.207
  • Latitude: 48.86
  • Longitude: 2.33
  • Country: France
  • City: Paris

HTTP Header Response

HTTP/1.1 200 OK Cache-Control: private Content-Length: 32084 Content-Type: text/html; charset=utf-8 Server: Microsoft-IIS/7.5 X-AspNet-Version: 2.0.50727 Set-Cookie: ASP.NET_SessionId=eyhpeczulxhqsk45wyjlbzrx; path=/; HttpOnly X-Powered-By: ASP.NET Date: Sat, 07 May 2016 12:35:57 GMT X-Cache: MISS from s_xt13 X-Cache-Lookup: MISS from s_xt13:80 Via: 1.1 s_xt13 (squid/3.5.13) Connection: keep-alive

DNS

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ivtravel.org, www.heivtravel.org, www.eivtravel.org, www.hdivtravel.org, www.divtravel.org, www.hcivtravel.org, www.civtravel.org, www.huivtravel.org, www.uivtravel.org, www.hjivtravel.org, www.jivtravel.org, www.hivtravel.org, www.ivtravel.org, www.hbivtravel.org, www.bivtravel.org, www.hgivtravel.org, www.givtravel.org, www.hvtravel.org, www.hirvtravel.org, www.hrvtravel.org, www.hifvtravel.org, www.hfvtravel.org, www.hivvtravel.org, www.hvvtravel.org, www.hikvtravel.org, www.hkvtravel.org, www.hi,vtravel.org, www.h,vtravel.org, www.hibvtravel.org, www.hbvtravel.org, www.higvtravel.org, www.hgvtravel.org, www.hitvtravel.org, www.htvtravel.org, www.hiyvtravel.org, www.hyvtravel.org, www.hiuvtravel.org, www.huvtravel.org, www.hijvtravel.org, www.hjvtravel.org, www.himvtravel.org, www.hmvtravel.org, www.hinvtravel.org, www.hnvtravel.org, www.hitravel.org, www.hivytravel.org, www.hiytravel.org, www.hivztravel.org, www.hiztravel.org, www.hivhtravel.org, www.hihtravel.org, www.hivntravel.org, www.hintravel.org, www.hivmtravel.org, www.himtravel.org, www.hivjtravel.org, www.hijtravel.org, www.hivktravel.org, www.hiktravel.org, www.hivitravel.org, www.hiitravel.org, www.hivravel.org, www.hivtqravel.org, www.hivqravel.org, www.hivtaravel.org, www.hivaravel.org, www.hivt ravel.org, www.hiv ravel.org, www.hivtwravel.org, www.hivwravel.org, www.hivteravel.org, www.hiveravel.org, www.hivtzravel.org, www.hivzravel.org, www.hivtxravel.org, www.hivxravel.org, www.hivtcravel.org, www.hivcravel.org, www.hivtavel.org, www.hivtriavel.org, www.hivtiavel.org, www.hivtroavel.org, www.hivtoavel.org, www.hivtrlavel.org, www.hivtlavel.org, www.hivtrlavel.org, www.hivtlavel.org, www.hivtr.avel.org, www.hivt.avel.org, www.hivtrvel.org, www.hivtraovel.org, www.hivtrovel.org, www.hivtrapvel.org, www.hivtrpvel.org, www.hivtra9vel.org, www.hivtr9vel.org, www.hivtravel.org, www.hivtrvel.org, www.hivtraivel.org, www.hivtrivel.org, www.hivtrauvel.org, www.hivtruvel.org, www.hivtrael.org, www.hivtravyel.org, www.hivtrayel.org, www.hivtravzel.org, www.hivtrazel.org, www.hivtravhel.org, www.hivtrahel.org, www.hivtravnel.org, www.hivtranel.org, www.hivtravmel.org, www.hivtramel.org, www.hivtravjel.org, www.hivtrajel.org, www.hivtravkel.org, www.hivtrakel.org, www.hivtraviel.org, www.hivtraiel.org, www.hivtravl.org, www.hivtravexl.org, www.hivtravxl.org, www.hivtravesl.org, www.hivtravsl.org, www.hivtravewl.org, www.hivtravwl.org, www.hivtraverl.org, www.hivtravrl.org, www.hivtravefl.org, www.hivtravfl.org, www.hivtravevl.org, www.hivtravvl.org, www.hivtravecl.org, www.hivtravcl.org, www.hivtraveql.org, www.hivtravql.org, www.hivtraveal.org, www.hivtraval.org, www.hivtraveyl.org, www.hivtravyl.org, www.hivtrave.org, www.hivtravelu.org, www.hivtraveu.org, www.hivtravel8.org, www.hivtrave8.org, www.hivtravel9.org, www.hivtrave9.org, www.hivtravelj.org, www.hivtravej.org, www.hivtravel0.org, www.hivtrave0.org, www.hivtravelm.org, www.hivtravem.org, www.hivtravelp.org, www.hivtravep.org, www.hivtravelo.org, www.hivtraveo.org,

Other websites we recently analyzed

  1. Alexandra Minna Stern Professor. Historian. Public Scholar - Home
    Alexandra Minna Stern
    San Francisco (United States) - 199.34.228.100
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript, Php, SVG, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 6
    Number of meta tags: 4
  2. CHEN WEI
    Tianjin (China) - 221.238.195.113
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html
    Number of meta tags: 2
  3. Henning80.de
    Germany - 31.47.241.100
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery UI, Php
    Number of Javascript: 4
    Number of meta tags: 1
  4. usvos.info
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  5. pleasegivewillyapleasemaamsir.org
    Scottsdale (United States) - 50.63.202.54
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  6. Marlboro Florists - Flowers in Marlboro NY - Love's Flowers
    Order flowers online with Same Day Delivery from Love's Flowers. Fresh flowers and hand delivered right to your door. Experience the Teleflora difference!
    Oklahoma City (United States) - 65.198.163.112
    Server software:
    Technology: CSS, Html, Iframe, Javascript, jQuery Cycle, Php, Maxymiser, Facebook Like box
    Number of Javascript: 10
    Number of meta tags: 1
  7. conjuegamos.com
    Switzerland - 141.8.224.247
    Server software: nginx/1.9.9
    Technology: Html
  8. Lisa Blue Rogers
    Lisa Rogers Studio site contains artwork done by Lisa Rogers
    New York (United States) - 198.185.159.144
    Server software:
    Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Squarespace
    Number of Javascript: 3
    Number of meta tags: 6
  9. psychotherapie.co
    Austria - 86.59.107.231
    Server software: squid/3.5.9
    Technology: Html
  10. Congratulations! Welcome to your new Web Site!
    Montréal (Canada) - 192.99.170.10
    Server software: Apache
    Technology: Html
    Number of meta tags: 1

Check Other Websites